1. Stock Photography
  2. Spain

Cádiz

Read More
San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea.
58 / 182

San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea.

leisurespare timefree timelandmarkmonumentmonumentalfamous placefamous placesdestinationtourismvacationholidayholidayssummersummertimeblue skyclear skyseaseascapewateroceancoastcoastalbeachseasideshorebayinletcovenobodysan sebastian castlecastillosan sebastiancastlefortressCadizAndalusiaAndalusianAndaluciaSpainSpanishEuropeseafrontmaleconfootbridgewalkwaystreetlampstreetlightstreet lampstreet light

  • Colorful, polarized image of Cadiz Cathedral.
  • Colorful, polarized image of Cadiz Cathedral.
  • Campo del Sur, the Cadiz southern seafront, is plenty of colorful houses.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city. Digital composite of a three shoots sequence.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea. Refreshing images of boys enjoying the sea in their own city.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea.
  • Refreshing, summery image of people on the sea.
  • San Sebastian castle in located on an island in front of Santa Catalina castle, over La Caleta cove. It is united to the mainland through a seafront wich is used nowadays by Cadiz people for bathing, swimming and diving on the sea.
  • No Comments
  • Photo Sharing
  • About SmugMug
  • Browse Photos
  • Prints & Gifts
  • Terms
  • Privacy
  • Contact
  • Owner Log In
© 2021 SmugMug, Inc.